Recombinant Full Length Bovine Transmembrane Protein 229B(Tmem229B) Protein, His-Tagged
Cat.No. : | RFL13332BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 229B(TMEM229B) Protein (Q5EA70) (1-167aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-167) |
Form : | Lyophilized powder |
AA Sequence : | MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV ERMYLRLRGRCPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY AVPWFCGALLVEQFVIRNTLRLRFDKDAEPGEPSGALALANGHVKTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM229B |
Synonyms | TMEM229B; Transmembrane protein 229B |
UniProt ID | Q5EA70 |
◆ Recombinant Proteins | ||
TMEM229B-4626R | Recombinant Rhesus Macaque TMEM229B Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmem229b-6492M | Recombinant Mouse Tmem229b Protein, Myc/DDK-tagged | +Inquiry |
TMEM229B-4812R | Recombinant Rhesus monkey TMEM229B Protein, His-tagged | +Inquiry |
TMEM229B-17007M | Recombinant Mouse TMEM229B Protein | +Inquiry |
RFL18158HF | Recombinant Full Length Human Transmembrane Protein 229B(Tmem229B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM229B-961HCL | Recombinant Human TMEM229B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM229B Products
Required fields are marked with *
My Review for All TMEM229B Products
Required fields are marked with *
0
Inquiry Basket