Recombinant Full Length Bovine Tumor Necrosis Factor(Tnf) Protein, His-Tagged
| Cat.No. : | RFL20611BF |
| Product Overview : | Recombinant Full Length Bovine Tumor necrosis factor(TNF) Protein (Q06599) (1-234aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-234) |
| Form : | Lyophilized powder |
| AA Sequence : | MSTKSMIRDVELAEEVLSEKAGGPQGSRSCLCLSLFSFLLVAGATTLFCLLHFGVIGPQREEQSPGGPSINSPLVQTLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | TNF |
| Synonyms | TNF; TNFA; TNFSF2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a) [Cleaved into: Tumor necrosis factor; membrane form; N-terminal fragment; NTF); Intracellular domain 1; ICD1); Intracellular domain 2 |
| UniProt ID | Q06599 |
| ◆ Recombinant Proteins | ||
| Tnf-3766M | Recombinant Mouse Tnf Protein (Leu80-Leu235), N-His tagged | +Inquiry |
| Tnf-494M | Recombinant Mouse Tnf protein, His-tagged | +Inquiry |
| TNF-531H | Recombinant Human TNF Protein | +Inquiry |
| TNF-480C | Active Recombinant Canine TNF | +Inquiry |
| TNF-5343H | Active Recombinant Human TNF protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *
