Recombinant Full Length Cat Long-Wave-Sensitive Opsin 1(Opn1Lw) Protein, His-Tagged
Cat.No. : | RFL13100FF |
Product Overview : | Recombinant Full Length Cat Long-wave-sensitive opsin 1(OPN1LW) Protein (O18913) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Felis catus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MTQRWGPQRLAGGQPHAGLEDSTRASIFTYTNSNATRGPFEGPNYHIAPRWVYHVTSAWM IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFV LGHPMCVLEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCIIPLSVIVLCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAYCVCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSASRTEASSVSS VSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OPN1LW |
Synonyms | OPN1LW; RCP; Long-wave-sensitive opsin 1; Red cone photoreceptor pigment; Red-sensitive opsin |
UniProt ID | O18913 |
◆ Recombinant Proteins | ||
OPN1LW-3728H | Recombinant Human OPN1LW Protein, His (Fc)-Avi-tagged | +Inquiry |
OPN1LW-6990C | Recombinant Chicken OPN1LW | +Inquiry |
OPN1LW-765C | Recombinant Cynomolgus OPN1LW Protein, His-tagged | +Inquiry |
RFL22560BF | Recombinant Full Length Bovine Long-Wave-Sensitive Opsin 1(Opn1Lw) Protein, His-Tagged | +Inquiry |
OPN1LW-509C | Recombinant Cynomolgus Monkey OPN1LW Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPN1LW Products
Required fields are marked with *
My Review for All OPN1LW Products
Required fields are marked with *
0
Inquiry Basket