Recombinant Full Length Cat Tumor Necrosis Factor(Tnf) Protein, His-Tagged
Cat.No. : | RFL6340FF |
Product Overview : | Recombinant Full Length Cat Tumor necrosis factor(TNF) Protein (P19101) (1-233aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Felis catus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-233) |
Form : | Lyophilized powder |
AA Sequence : | MSTESMIRDVELAEEALPKKAGGPQGSGRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQREELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSTEINLPAYLDFAESGQVYFGIIAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TNF |
Synonyms | TNF; TNFA; TNFSF2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a |
UniProt ID | P19101 |
◆ Recombinant Proteins | ||
TNF-202P | Active Recombinant Pig TNF Protein (Leu77-Leu232), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TNFSF11-208HAF488 | Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNF-6471H | Recombinant Human TNF Protein (Gly57-Leu233), N-His tagged | +Inquiry |
Tnf-509M | Active Recombinant Mouse Tnf | +Inquiry |
Tnf-016T | Active Recombinant Mouse Tnf Protein (157 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *
0
Inquiry Basket