Recombinant Full Length Chicken Abhydrolase Domain-Containing Protein 13(Abhd13) Protein, His-Tagged
Cat.No. : | RFL1471GF |
Product Overview : | Recombinant Full Length Chicken Abhydrolase domain-containing protein 13(ABHD13) Protein (Q5ZJL8) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MEKSRMLWTFVERWLLALASWSWGLCRISLLPLIVTFHLYGGIILLLLIFVSIAGILYKF QDMLLYFPEQPSSSRLYVPMPTGIPHENIFIKTKDGVLLNLILLRYTGDNAAYSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSEGEASEEGLYIDSEAVLDYVMTRS DLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPL WCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPARTKRLAIFPDGTHND TWQCQGYFTALEQFIKEVIKSHSSEEMAKTSSNVTII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABHD13 |
Synonyms | ABHD13; RCJMB04_17d11; Protein ABHD13; Alpha/beta hydrolase domain-containing protein 13; Abhydrolase domain-containing protein 13 |
UniProt ID | Q5ZJL8 |
◆ Recombinant Proteins | ||
ABHD13-16R | Recombinant Rhesus Macaque ABHD13 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD13-1866C | Recombinant Chicken ABHD13 | +Inquiry |
RFL31160MF | Recombinant Full Length Mouse Abhydrolase Domain-Containing Protein 13(Abhd13) Protein, His-Tagged | +Inquiry |
ABHD13-3579Z | Recombinant Zebrafish ABHD13 | +Inquiry |
RFL26013XF | Recombinant Full Length Xenopus Laevis Abhydrolase Domain-Containing Protein 13(Abhd13) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD13-9138HCL | Recombinant Human ABHD13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD13 Products
Required fields are marked with *
My Review for All ABHD13 Products
Required fields are marked with *