Recombinant Full Length Chicken Heme Transporter Hrg1(Slc48A1) Protein, His-Tagged
Cat.No. : | RFL2359GF |
Product Overview : | Recombinant Full Length Chicken Heme transporter HRG1(SLC48A1) Protein (Q5ZHU0) (1-147aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-147) |
Form : | Lyophilized powder |
AA Sequence : | MAVSRALALRLAYAAAGALMGFSAFFTWSLAPAFRQPATAAAGGLSGVLALWALITHVMY VQDYWRTWLKGLRFFLFIGILFSALSVVGFCTFLVLAITQHQSLTDPRSYYLSCVWSFIS LKWAFLLSLYAYRYRNEFADISILSDF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC48A1 |
Synonyms | SLC48A1; HRG1; RCJMB04_33e14; Heme transporter HRG1; Heme-responsive gene 1 protein homolog; HRG-1; Solute carrier family 48 member 1 |
UniProt ID | Q5ZHU0 |
◆ Recombinant Proteins | ||
SLC48A1-5547R | Recombinant Rat SLC48A1 Protein | +Inquiry |
RFL2359GF | Recombinant Full Length Chicken Heme Transporter Hrg1(Slc48A1) Protein, His-Tagged | +Inquiry |
RFL5723RF | Recombinant Full Length Rat Heme Transporter Hrg1(Slc48A1) Protein, His-Tagged | +Inquiry |
SLC48A1-4113R | Recombinant Rhesus Macaque SLC48A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC48A1-5206R | Recombinant Rat SLC48A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC48A1-609HCL | Recombinant Human SLC48A1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC48A1 Products
Required fields are marked with *
My Review for All SLC48A1 Products
Required fields are marked with *