Recombinant Full Length Chicken Integral Membrane Protein 2B(Itm2B) Protein, His-Tagged
Cat.No. : | RFL1749GF |
Product Overview : | Recombinant Full Length Chicken Integral membrane protein 2B(ITM2B) Protein (O42204) (1-262aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-262) |
Form : | Lyophilized powder |
AA Sequence : | MVKVSFNSALAHKEAANKEEENSQVLILPPDAKEPEDVVVPAGHKRAWCWCMCFGLAFMLAGVILGGAYLYKYFAFQQGGVYFCGIKYIEDGLSLPESGAQLKSARYHTIEQNIQILEEEDVEFISVPVPEFADSDPADIVHDFHRRLTAYLDLSLDKCYVIPLNTSVVMPPKNFLELLINIKAGTYLPQSYLIHEQMIVTDRIENVDQLGFFIYRLCRGKETYKLQRKEAMKGIQKREAVNCRKIRHFENRFAMETLICEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ITM2B |
Synonyms | ITM2B; Integral membrane protein 2B; Transmembrane protein E3-16 |
UniProt ID | O42204 |
◆ Recombinant Proteins | ||
ITM2B-120H | Recombinant Human ITM2B, His-tagged | +Inquiry |
RFL1149MF | Recombinant Full Length Mouse Integral Membrane Protein 2B(Itm2B) Protein, His-Tagged | +Inquiry |
ITM2B-378C | Recombinant Cynomolgus Monkey ITM2B Protein, His (Fc)-Avi-tagged | +Inquiry |
ITM2B-6642C | Recombinant Chicken ITM2B | +Inquiry |
ITM2B-8382M | Recombinant Mouse ITM2B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2B-5117HCL | Recombinant Human ITM2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITM2B Products
Required fields are marked with *
My Review for All ITM2B Products
Required fields are marked with *
0
Inquiry Basket