Recombinant Full Length Chicken Neuronal Acetylcholine Receptor Subunit Beta-4(Chrnb4) Protein, His-Tagged
Cat.No. : | RFL21422GF |
Product Overview : | Recombinant Full Length Chicken Neuronal acetylcholine receptor subunit beta-4(CHRNB4) Protein (P26153) (4-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (4-470) |
Form : | Lyophilized powder |
AA Sequence : | ADAEEKLMNHLLSPDRYNKLIRPAVNSSQLVSIELQVSLAQLISVNEREQIMTTNVWLNQ EWIDYRLAWKPSDYEGINMLRIPAKHIWLPDIVLYNNADGTYEVSLYTNAIVQNNGSIRW LPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKTSMASMDDFTPSGEWDI VALPGRRTENPLDPNYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRS PSTHTMPPWVKLVFLERLPAYLFMKRPENNSPRQKPANCKKTRAENLCMDPADFYKNSTY FVNTASAKKYDMKITDTLDNVSSHQDFRLRTGTKFSPEVQEAIDGVSFIAEHMKSDDNDQ SVIEDWKYVAMVVDRLFLWIFVLVCVLGTVGLFLQPLFQNHIAATNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHRNB4 |
Synonyms | CHRNB4; Neuronal acetylcholine receptor subunit beta-4; Neuronal acetylcholine receptor non-alpha-3 chain; N-alpha 3; Fragment |
UniProt ID | P26153 |
◆ Recombinant Proteins | ||
CHRNB4-1290H | Recombinant Human CHRNB4 Protein, GST-Tagged | +Inquiry |
CHRNB4-6382C | Recombinant Chicken CHRNB4 | +Inquiry |
CHRNB4-782H | Recombinant Human CHRNB4 Protein, His-tagged | +Inquiry |
RFL21422GF | Recombinant Full Length Chicken Neuronal Acetylcholine Receptor Subunit Beta-4(Chrnb4) Protein, His-Tagged | +Inquiry |
RFL10086MF | Recombinant Full Length Mouse Neuronal Acetylcholine Receptor Subunit Beta-4(Chrnb4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNB4-7511HCL | Recombinant Human CHRNB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNB4 Products
Required fields are marked with *
My Review for All CHRNB4 Products
Required fields are marked with *
0
Inquiry Basket