Recombinant Full Length Chicken Nucleolar Complex Protein 4 Homolog(Noc4L) Protein, His-Tagged
Cat.No. : | RFL25496GF |
Product Overview : | Recombinant Full Length Chicken Nucleolar complex protein 4 homolog(NOC4L) Protein (Q5ZJC7) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MARPALAASLEAVLGDRGNANRVFEILELLAAKEEEDVLCAARTCRRLFAALLRRGELFA GSLPAEEDALRGNYSAEEKYKIWMRHRYNDCVESLSELLGHDSFQVKESSLCTLMKFVEL EAECPLVAEQWKGSIAFPRHLLKVVVNGLIPIHEDASLLISRFQEYMEYEDVRYFVMKVV TESIGQVMQKIKERPLPFYQQNVFSLISPINMPNKERDMVKFMMKQDNREEWKVSKLQAH KQAFERMWLTFLKHQLPSGLYKKVLVILHDSILPYMNEPTLMIDFLTVAYGVGGAISLLA LNGLFILIHQHNLEYPDFYKKLYSLLDPSIYHVKYRARFFHLADLFLSSSHLPAYLVAAF IKRLSRLALTAPPEALLMVIPFICNLFRRHPACKVLMHRPNGPQDLSEDPYIMEQEEPSE SRALESSLWELQSLQNHYHPDVAQAAAILNQSLSEIEDDISGLLELSASELFDKEIKKTS ANVPLEFEQVRGLFGKKNDIIAEHFALD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NOC4L |
Synonyms | NOC4L; RCJMB04_19e8; Nucleolar complex protein 4 homolog; NOC4 protein homolog; NOC4-like protein; Nucleolar complex-associated protein 4-like protein |
UniProt ID | Q5ZJC7 |
◆ Recombinant Proteins | ||
RFL25496GF | Recombinant Full Length Chicken Nucleolar Complex Protein 4 Homolog(Noc4L) Protein, His-Tagged | +Inquiry |
NOC4L-3061R | Recombinant Rhesus monkey NOC4L Protein, His-tagged | +Inquiry |
NOC4L-10764M | Recombinant Mouse NOC4L Protein | +Inquiry |
NOC4L-5962H | Recombinant Human NOC4L Protein, GST-tagged | +Inquiry |
NOC4L-6127M | Recombinant Mouse NOC4L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOC4L-3773HCL | Recombinant Human NOC4L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOC4L Products
Required fields are marked with *
My Review for All NOC4L Products
Required fields are marked with *
0
Inquiry Basket