Recombinant Full Length Chicken Phosphatidylserine Synthase 2(Ptdss1) Protein, His-Tagged
Cat.No. : | RFL18343GF |
Product Overview : | Recombinant Full Length Chicken Phosphatidylserine synthase 2(PTDSS1) Protein (E1BYA3) (1-442aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-442) |
Form : | Lyophilized powder |
AA Sequence : | MRRGERRGPAGPLGDGPALGLRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLL EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI LFQTVQDGRQFMKYIDPHLGVPLPERDYGGNCLIYDPGNESDPFHNIWDKLDGFVPAHFF GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVILCNGLGIYCGM KTLSWLSLKTYKWQGLWNIPTYKGKMKRIVFQFTPYSWVKFEWKPASSLRRWLAVCGIIF VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDDPKFHKKLGQQA WLVAAITATEFLIVVKYDPYTLTLSLPFYITQCWILGIILVLTWTAWRFFIRDITLRYKE IRRQKQEHKYEKDKCLSNGDGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTDSS1 |
Synonyms | PTDSS1; Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2; Serine-exchange enzyme II |
UniProt ID | E1BYA3 |
◆ Recombinant Proteins | ||
Ptdss1-5215M | Recombinant Mouse Ptdss1 Protein, Myc/DDK-tagged | +Inquiry |
PTDSS1-3151C | Recombinant Chicken PTDSS1 | +Inquiry |
RFL18343GF | Recombinant Full Length Chicken Phosphatidylserine Synthase 2(Ptdss1) Protein, His-Tagged | +Inquiry |
PTDSS1-4798R | Recombinant Rat PTDSS1 Protein | +Inquiry |
PTDSS1-3503R | Recombinant Rhesus Macaque PTDSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTDSS1-2722HCL | Recombinant Human PTDSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTDSS1 Products
Required fields are marked with *
My Review for All PTDSS1 Products
Required fields are marked with *
0
Inquiry Basket