Recombinant Full Length Chicken Pq-Loop Repeat-Containing Protein 2(Pqlc2) Protein, His-Tagged
Cat.No. : | RFL19601GF |
Product Overview : | Recombinant Full Length Chicken PQ-loop repeat-containing protein 2(PQLC2) Protein (Q5ZJX0) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MAEGLRAPPPPGNGSECPDGARWVLRLLGECARDGRDVGSALLGLLSIGCFAAAALPQFY QACKTGIMDRALSIYFLLGWLGGDLLNLIGSFLANQLPLQVYTAVYYVLADLVMLSLYGY YKAKNWGTGATASINAACLFCLLGTATTLTVLSHDTGPAPNPAAFGGRSLLSLGLEGPGP EPISKTEIIGFAIGSISSVLYLCSRLPQIYTNYRRKSTAGVSFLLFALVMLGNLLYGTSV LLKNPEPGQSEGDYILHHLPWLIGSLGVLSLDVIISFQFLAYRTGQPSAGEEREALLAEH GDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PQLC2 |
Synonyms | SLC66A1; PQLC2; RCJMB04_14o18; Lysosomal amino acid transporter 1 homolog; PQ-loop repeat-containing protein 2; Solute carrier family 66 member 1 |
UniProt ID | Q5ZJX0 |
◆ Recombinant Proteins | ||
PQLC2-7056M | Recombinant Mouse PQLC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PQLC2-1449C | Recombinant Chicken PQLC2 | +Inquiry |
PQLC2-2101Z | Recombinant Zebrafish PQLC2 | +Inquiry |
RFL21987HF | Recombinant Full Length Human Pq-Loop Repeat-Containing Protein 2(Pqlc2) Protein, His-Tagged | +Inquiry |
RFL16134MF | Recombinant Full Length Mouse Pq-Loop Repeat-Containing Protein 2(Pqlc2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PQLC2-2901HCL | Recombinant Human PQLC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PQLC2 Products
Required fields are marked with *
My Review for All PQLC2 Products
Required fields are marked with *