Recombinant Full Length Chicken Sodium/Potassium-Transporting Atpase Subunit Beta-3(Atp1B3) Protein, His-Tagged
| Cat.No. : | RFL-19415GF |
| Product Overview : | Recombinant Full Length Chicken Sodium/potassium-transporting ATPase subunit beta-3(ATP1B3) Protein (P33879) (1-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-280) |
| Form : | Lyophilized powder |
| AA Sequence : | MSKETKKPFRQSVAEWRQFVYNPNSGEFLGRTAKSWGLILLFYLVFYGFLAALFTFTMWVMLQTLSNDIPKYRDRISSPGLMISPKPDTALEFYFNKSDAQSYAEYVSTLRKFLETYDDSKQSQNINCTPGKVFDQNDVAVKKACRFNLSELGQCSGKEDKTFGYSKGTPCVLVKMNRIIGLKPEGEPYIQCTSKEPGAVEINYFPSGGLIDLMYFPYYGKTLHAHYLQPLVAVQLAINSNSTNEEIAIECKILGSPNLKNEDDRDKFLGRIAFKVEMTE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ATP1B3 |
| Synonyms | ATP1B3; Sodium/potassium-transporting ATPase subunit beta-3; Sodium/potassium-dependent ATPase subunit beta-3 |
| UniProt ID | P33879 |
| ◆ Recombinant Proteins | ||
| RFL-2180HF | Recombinant Full Length Human Sodium/Potassium-Transporting Atpase Subunit Beta-3(Atp1B3) Protein, His-Tagged | +Inquiry |
| ATP1B3-7083C | Recombinant Chicken ATP1B3 | +Inquiry |
| ATP1B3-01M | Recombinant Mouse ATP1B3 Protein, Fc-tagged | +Inquiry |
| ATP1B3-450R | Recombinant Rhesus monkey ATP1B3 Protein, His-tagged | +Inquiry |
| ATP1B3-967H | Recombinant Human ATP1B3 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP1B3-061HKCL | Human ATP1B3 Knockdown Cell Lysate | +Inquiry |
| ATP1B3-8610HCL | Recombinant Human ATP1B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP1B3 Products
Required fields are marked with *
My Review for All ATP1B3 Products
Required fields are marked with *



