Recombinant Human ATP1B3 protein

Cat.No. : ATP1B3-967H
Product Overview : Human ATP1B3 full-length ORF (NP_001670.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq, Jul 2008]
Molecular Mass : 31.5 kDa
AA Sequence : MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Applications : Antibody Production; Functional Study; Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name ATP1B3 ATPase, Na+/K+ transporting, beta 3 polypeptide [ Homo sapiens ]
Official Symbol ATP1B3
Synonyms ATP1B3; ATPase, Na+/K+ transporting, beta 3 polypeptide; sodium/potassium-transporting ATPase subunit beta-3; CD298; FLJ29027; Na, K-ATPase beta-3 polypeptide; sodium/potassium-dependent ATPase beta-3 subunit; sodium/potassium-dependent ATPase subunit beta-3; sodium/potassium-transporting ATPase beta-3 chain; ATPB-3;
Gene ID 483
mRNA Refseq NM_001679
Protein Refseq NP_001670
MIM 601867
UniProt ID P54709

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP1B3 Products

Required fields are marked with *

My Review for All ATP1B3 Products

Required fields are marked with *

0
cart-icon
0
compare icon