Recombinant Full Length Chicken T-Cell-Specific Surface Glycoprotein Cd28 Homolog(Cd28) Protein, His-Tagged
Cat.No. : | RFL10568GF |
Product Overview : | Recombinant Full Length Chicken T-cell-specific surface glycoprotein CD28 homolog(CD28) Protein (P31043) (14-221aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (14-221) |
Form : | Lyophilized powder |
AA Sequence : | ADVTENKILVAQRPLLIVANRTATLVCNYTYNGTGKEFRASLHKGTDSAVEVCFISWNMTKINSNSNKEFNCRGIHDKDKVIFNLWNMSASQTDIYFCKIEAMYPPPYVYNEKSNGTVIHVRETPIQTQEPESATSYWVMVAVTGLLGFYSMLITAVFIIYRQKSKRNRYRQSDYMNMTPRHPPHQKNKGYPSYAPTRDYTAYRSWQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD28 |
Synonyms | CD28; T-cell-specific surface glycoprotein CD28 homolog; CHT28 |
UniProt ID | P31043 |
◆ Recombinant Proteins | ||
CD28-625M | Recombinant Mouse CD28 Protein, Fc-tagged | +Inquiry |
CD28-1204C | Active Recombinant Cynomolgus CD28 protein(Met1-Pro152), hFc-tagged | +Inquiry |
CD28-747HB | Recombinant Human CD28 protein, His-Avi-tagged, Biotinylated | +Inquiry |
Cd28-661M | Recombinant Mouse Cd28 protein, His & GST-tagged | +Inquiry |
CD28-559R | Recombinant Rhesus Macaque CD28 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CD28-22H | Active Recombinant Human CD28 Homodimer Protein, His tagged | +Inquiry |
Cd28-23M | Active Recombinant Mouse CD28 Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD28-2013HCL | Recombinant Human CD28 cell lysate | +Inquiry |
CD28-2002MCL | Recombinant Mouse CD28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD28 Products
Required fields are marked with *
My Review for All CD28 Products
Required fields are marked with *