Recombinant Full Length Chicken Transmembrane Protein 70, Mitochondrial(Tmem70) Protein, His-Tagged
| Cat.No. : | RFL20901GF |
| Product Overview : | Recombinant Full Length Chicken Transmembrane protein 70, mitochondrial(TMEM70) Protein (Q5ZLJ4) (80-246aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (80-246) |
| Form : | Lyophilized powder |
| AA Sequence : | HPEHGRLVYKGNLAKAVLGVRFFSYSTSIFNLFMAPYLMLKTGIGFDSLFLQAAFYGLIG FFTFVTPVTLHILTKGYVIRLYYKEEMDTYTAITYNAILAEKATVFHQKDVKIPDITKMF TTFYAKTKSMLVNPTLFPDPQDYNRLMGYDKAFCFDFEEEEKDGESK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | TMEM70 |
| Synonyms | TMEM70; RCJMB04_5o22; Transmembrane protein 70, mitochondrial |
| UniProt ID | Q5ZLJ4 |
| ◆ Recombinant Proteins | ||
| TMEM70-5761H | Recombinant Human TMEM70 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMEM70-2071C | Recombinant Chicken TMEM70 | +Inquiry |
| RFL15815BF | Recombinant Full Length Bovine Transmembrane Protein 70, Mitochondrial(Tmem70) Protein, His-Tagged | +Inquiry |
| Tmem70-6513M | Recombinant Mouse Tmem70 Protein, Myc/DDK-tagged | +Inquiry |
| TMEM70-17075M | Recombinant Mouse TMEM70 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM70-934HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
| TMEM70-935HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM70 Products
Required fields are marked with *
My Review for All TMEM70 Products
Required fields are marked with *



