Recombinant Full Length Chicken Voltage-Dependent L-Type Calcium Channel Subunit Alpha-1S(Cacna1S) Protein, His-Tagged
Cat.No. : | RFL21739GF |
Product Overview : | Recombinant Full Length Chicken Voltage-dependent L-type calcium channel subunit alpha-1S(CACNA1S) Protein (O42398) (1-281aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-281) |
Form : | Lyophilized powder |
AA Sequence : | VGFVIVTFQEQGESEYKNCELDKNQRQCVQYALKARPLRRYIPKNPYQYQIWYVVTSSYF EYLMFFLIMLNTICLGMQHYNQSAEMNHVSDILNVAFTVLFTLEMILKLMAFKAKGYFGD PWNVFDFLIVIGSIIDVILSEIDDPDDNSRVSITFFRLFRVMRLVKLLSRGEGVRTLLWT FIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRC ATGEAWQEILLDCSYGKRCDPESDYAEGEEYTCGTGFAYFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CACNA1S |
Synonyms | CACNA1S; Voltage-dependent L-type calcium channel subunit alpha-1S; Voltage-gated calcium channel subunit alpha Cav1.1; Fragment |
UniProt ID | O42398 |
◆ Recombinant Proteins | ||
CACNA1S-0268H | Recombinant Human CACNA1S Protein, GST-Tagged | +Inquiry |
CACNA1S-1715H | Recombinant Human CACNA1S protein, His & T7-tagged | +Inquiry |
Cacna1s-1422M | Recombinant Mouse Cacna1s protein, His & T7-tagged | +Inquiry |
CACNA1S-119H | Recombinant Human CACNA1S protein, His-tagged | +Inquiry |
Cacna1s-1716R | Recombinant Rat Cacna1s protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA1S Products
Required fields are marked with *
My Review for All CACNA1S Products
Required fields are marked with *