Recombinant Full Length Ciona Intestinalis Voltage-Gated Hydrogen Channel 1(Hvcn1) Protein, His-Tagged
| Cat.No. : | RFL31952CF |
| Product Overview : | Recombinant Full Length Ciona intestinalis Voltage-gated hydrogen channel 1(HVCN1) Protein (Q1JV40) (1-342aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Ciona Intestinalis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-342) |
| Form : | Lyophilized powder |
| AA Sequence : | MEGDNCNKSRHKSHNMINPNYASVRCTQPLPSVIQLRSRNKMIGITEDPSSDSEPVSSNQ PLLLTNLSYEVHTFNDNNNHERPAPQEQSTQNTMISMQSEQKSDRFTASNLGMFQYMKFE IGEDGDDHEEEAILTNREKLRHILHSKPIHVAIIVLVVLDSFLVVGELLIDLKVIIVPHG NPAPEILHGFSLSILSIFMVEIALKIIADHRHFIHHKVEVLDAVVVVISFGVDIALIFVG ESEALAAIGLLVILRLWRVFRIINGIIVTVKTKADDRVHEIKKKNSELELQIHNLEEKLS QKEQDMSRLHEILRCNNIDIPPTVPLTTSVQIHSTTTASADV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | HVCN1 |
| Synonyms | HVCN1; VSOP; VSX1; Voltage-gated hydrogen channel 1; Hydrogen voltage-gated channel 1; HV1; Voltage sensor domain-only protein |
| UniProt ID | Q1JV40 |
| ◆ Recombinant Proteins | ||
| Hvcn1-3463M | Recombinant Mouse Hvcn1 Protein, Myc/DDK-tagged | +Inquiry |
| RFL11608HF | Recombinant Full Length Human Voltage-Gated Hydrogen Channel 1(Hvcn1) Protein, His-Tagged | +Inquiry |
| HVCN1-494Z | Recombinant Zebrafish HVCN1 | +Inquiry |
| HVCN1-5224H | Recombinant Human HVCN1 Protein | +Inquiry |
| RFL31952CF | Recombinant Full Length Ciona Intestinalis Voltage-Gated Hydrogen Channel 1(Hvcn1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HVCN1-340HCL | Recombinant Human HVCN1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HVCN1 Products
Required fields are marked with *
My Review for All HVCN1 Products
Required fields are marked with *



