Recombinant Full Length Danio Rerio Cysteine-Rich And Transmembrane Domain-Containing Protein 1(Cystm1) Protein, His-Tagged
| Cat.No. : | RFL24427DF |
| Product Overview : | Recombinant Full Length Danio rerio Cysteine-rich and transmembrane domain-containing protein 1(cystm1) Protein (A5PLE2) (1-118aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-118) |
| Form : | Lyophilized powder |
| AA Sequence : | MNYEQPPAYTGPGPAPGYPAQGYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGYPNYPPGP PGPYTAQPGYQGYPQPGPPTNTVYVVEQGRRDDQSGEQACLATCWAALCCCCLCDMLT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | cystm1 |
| Synonyms | cystm1; zgc:165573; Cysteine-rich and transmembrane domain-containing protein 1 |
| UniProt ID | A5PLE2 |
| ◆ Recombinant Proteins | ||
| Cystm1-1349M | Recombinant Mouse Cystm1 Protein, Myc/DDK-tagged | +Inquiry |
| RFL24427DF | Recombinant Full Length Danio Rerio Cysteine-Rich And Transmembrane Domain-Containing Protein 1(Cystm1) Protein, His-Tagged | +Inquiry |
| CYSTM1-1378H | Recombinant Human CYSTM1 | +Inquiry |
| CYSTM1-1167R | Recombinant Rhesus monkey CYSTM1 Protein, His-tagged | +Inquiry |
| CYSTM1-992R | Recombinant Rhesus Macaque CYSTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYSTM1-8015HCL | Recombinant Human C5orf32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All cystm1 Products
Required fields are marked with *
My Review for All cystm1 Products
Required fields are marked with *
