Recombinant Full Length Danio Rerio Cytochrome C Oxidase Protein 20 Homolog(Cox20) Protein, His-Tagged
Cat.No. : | RFL10334DF |
Product Overview : | Recombinant Full Length Danio rerio Cytochrome c oxidase protein 20 homolog(cox20) Protein (Q6DH88) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MTEEDGKTQGMKVLGILDIHNTPCAREAILHGAAGSVAAGLLHFLATSRVKRSFDVGVAG FMITTLGSWFYCRYNNAKLRFQQRIIQEGLKNKVFYEGTDLDPTLKKTGDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cox20 |
Synonyms | cox20; fam36a; zgc:92598; Cytochrome c oxidase assembly protein COX20, mitochondrial |
UniProt ID | Q6DH88 |
◆ Recombinant Proteins | ||
COX20-5042C | Recombinant Chicken COX20 | +Inquiry |
COX20-2002HF | Recombinant Full Length Human COX20 Protein, GST-tagged | +Inquiry |
RFL10334DF | Recombinant Full Length Danio Rerio Cytochrome C Oxidase Protein 20 Homolog(Cox20) Protein, His-Tagged | +Inquiry |
COX20-986R | Recombinant Rhesus monkey COX20 Protein, His-tagged | +Inquiry |
COX20-570H | Recombinant Human COX20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cox20 Products
Required fields are marked with *
My Review for All cox20 Products
Required fields are marked with *
0
Inquiry Basket