Recombinant Full Length Danio Rerio Mpv17-Like Protein 2(Mpv17L2) Protein, His-Tagged
| Cat.No. : | RFL24500DF |
| Product Overview : | Recombinant Full Length Danio rerio Mpv17-like protein 2(mpv17l2) Protein (Q6DGV7) (1-199aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-199) |
| Form : | Lyophilized powder |
| AA Sequence : | MISRQGKEFLVRIAGYWKPLFRGRFLIVTNTVSCGGMLAAGDLIQQTREIRRTPGRTRDW SRTGCMFAVGCSMGPFMHYWYQWLDKYFIGNGINNVCKKVLVDQLVASPTLGAWYFLGMG MMEGHTFIEAQQEFRDKFWEFYKADWCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYL SYLKHRDTVEVTKEADGTA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | mpv17l2 |
| Synonyms | mpv17l2; zgc:92754; Mpv17-like protein 2 |
| UniProt ID | Q6DGV7 |
| ◆ Recombinant Proteins | ||
| MPV17L2-2819R | Recombinant Rhesus monkey MPV17L2 Protein, His-tagged | +Inquiry |
| RFL24500DF | Recombinant Full Length Danio Rerio Mpv17-Like Protein 2(Mpv17L2) Protein, His-Tagged | +Inquiry |
| MPV17L2-5523H | Recombinant Human MPV17L2 Protein | +Inquiry |
| RFL4462BF | Recombinant Full Length Bovine Mpv17-Like Protein 2(Mpv17L2) Protein, His-Tagged | +Inquiry |
| Mpv17l2-4130M | Recombinant Mouse Mpv17l2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPV17L2-4220HCL | Recombinant Human MPV17L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mpv17l2 Products
Required fields are marked with *
My Review for All mpv17l2 Products
Required fields are marked with *



