Recombinant Human MPV17L2 Protein

• Cat.No.: MPV17L2-5523H
• Product Overview: Human MPV17L2 full-length ORF (ADZ15803.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: MPV17L2 (MPV17 Mitochondrial Inner Membrane Protein Like 2) is a Protein Coding gene. Among its related pathways are Peroxisome. An important paralog of this gene is MPV17.
• Form: Liquid
• Molecular Mass: 20 kDa
• AA Sequence: MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: MPV17L2 MPV17 mitochondrial membrane protein-like 2 [ Homo sapiens ]
• Official Symbol: MPV17L2
• Synonyms: MPV17L2; MPV17 mitochondrial membrane protein-like 2; mpv17-like protein 2; FKSG24; MGC12972; MGC110861
• Gene ID: 84769
• mRNA Refseq: NM_032683
• Protein Refseq: NP_116072
• UniProt ID: Q567V2