Recombinant Human MPV17L2 Protein
| Cat.No. : | MPV17L2-5523H |
| Product Overview : | Human MPV17L2 full-length ORF (ADZ15803.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | MPV17L2 (MPV17 Mitochondrial Inner Membrane Protein Like 2) is a Protein Coding gene. Among its related pathways are Peroxisome. An important paralog of this gene is MPV17. |
| Form : | Liquid |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | MPV17L2 MPV17 mitochondrial membrane protein-like 2 [ Homo sapiens ] |
| Official Symbol | MPV17L2 |
| Synonyms | MPV17L2; MPV17 mitochondrial membrane protein-like 2; mpv17-like protein 2; FKSG24; MGC12972; MGC110861; |
| Gene ID | 84769 |
| mRNA Refseq | NM_032683 |
| Protein Refseq | NP_116072 |
| UniProt ID | Q567V2 |
| ◆ Cell & Tissue Lysates | ||
| MPV17L2-4220HCL | Recombinant Human MPV17L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPV17L2 Products
Required fields are marked with *
My Review for All MPV17L2 Products
Required fields are marked with *
