Recombinant Human MPV17L2 Protein

Cat.No. : MPV17L2-5523H
Product Overview : Human MPV17L2 full-length ORF (ADZ15803.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : MPV17L2 (MPV17 Mitochondrial Inner Membrane Protein Like 2) is a Protein Coding gene. Among its related pathways are Peroxisome. An important paralog of this gene is MPV17.
Form : Liquid
Molecular Mass : 20 kDa
AA Sequence : MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name MPV17L2 MPV17 mitochondrial membrane protein-like 2 [ Homo sapiens ]
Official Symbol MPV17L2
Synonyms MPV17L2; MPV17 mitochondrial membrane protein-like 2; mpv17-like protein 2; FKSG24; MGC12972; MGC110861;
Gene ID 84769
mRNA Refseq NM_032683
Protein Refseq NP_116072
UniProt ID Q567V2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPV17L2 Products

Required fields are marked with *

My Review for All MPV17L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon