Recombinant Full Length Danio Rerio Prostaglandin E Synthase 2(Ptges2) Protein, His-Tagged
Cat.No. : | RFL26151DF |
Product Overview : | Recombinant Full Length Danio rerio Prostaglandin E synthase 2(ptges2) Protein (Q7ZUC7) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MAAACTRTLGKVGRLVLDTPTCRFTNTAAFVPRTSMRCQGRAYGTGSSGFKSRLLLAAPV RGSGRVLGCAFLLGGGFGLYQTIKLTLQHHLAEKESDASDLDTDLKLTLYQYKTCPFCSK VRAFLDYHRLPYEIVEVNPVMRQEIKWSTYRKVPILMVNGTVQLNDSSVIISALKTYISS KDKKISEILACYPEMKSKNDRGKDVIEFGNKYWVMVHDADADQLYPGKDSRKEEIKWRTW ADDWLVHLISPNVYRTPTEALASFDYIVREGKFGSFEGFFAKYFGAAAMWIISKRLKYKH NLQADVRQDLYKAVNDWVAAIGKNKQFMGGDEPNLADLAVFGVLRVMEGLQSFDDMMEHT KVKKWYSRMQKATQHVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ptges2 |
Synonyms | ptges2; pges2; ptgesl; Prostaglandin E synthase 2; Microsomal prostaglandin E synthase 2; mPGES-2 |
UniProt ID | Q7ZUC7 |
◆ Recombinant Proteins | ||
Ptges2-5624M | Recombinant Mouse Ptges2 protein, His-tagged | +Inquiry |
PTGES2-571C | Recombinant Cynomolgus Monkey PTGES2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGES2-828C | Recombinant Cynomolgus PTGES2 Protein, His-tagged | +Inquiry |
PTGES2-2045H | Recombinant Human PTGES2 protein, GST-tagged | +Inquiry |
PTGES2-993H | Recombinant Human Prostaglandin E Synthase 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGES2-2714HCL | Recombinant Human PTGES2 293 Cell Lysate | +Inquiry |
PTGES2-2713HCL | Recombinant Human PTGES2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ptges2 Products
Required fields are marked with *
My Review for All ptges2 Products
Required fields are marked with *