Recombinant Human UNC50 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UNC50-988H |
Product Overview : | UNC50 MS Standard C13 and N15-labeled recombinant protein (NP_054763) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | UNC50 (Unc-50 Inner Nuclear Membrane RNA Binding Protein) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include RNA binding. |
Molecular Mass : | 30.4 kDa |
AA Sequence : | MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UNC50 unc-50 inner nuclear membrane RNA binding protein [ Homo sapiens (human) ] |
Official Symbol | UNC50 |
Synonyms | UNC50; unc-50 homolog (C. elegans); protein unc-50 homolog; GMH1; UNCL; URP; hGMH1; PDLs22; unc-50 related; protein GMH1 homolog; uncoordinated-like protein; periodontal ligament-specific protein 22; geal-6 membrane-associated high-copy suppressor 1; HSD23; DKFZp564G0222; |
Gene ID | 25972 |
mRNA Refseq | NM_014044 |
Protein Refseq | NP_054763 |
MIM | 617826 |
UniProt ID | Q53HI1 |
◆ Recombinant Proteins | ||
UNC50-5107R | Recombinant Rhesus monkey UNC50 Protein, His-tagged | +Inquiry |
UNC50-9915M | Recombinant Mouse UNC50 Protein, His (Fc)-Avi-tagged | +Inquiry |
Unc50-6838M | Recombinant Mouse Unc50 Protein, Myc/DDK-tagged | +Inquiry |
UNC50-10587Z | Recombinant Zebrafish UNC50 | +Inquiry |
UNC50-4920R | Recombinant Rhesus Macaque UNC50 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC50 Products
Required fields are marked with *
My Review for All UNC50 Products
Required fields are marked with *
0
Inquiry Basket