Recombinant Full Length Danio Rerio Protein Yipf4(Yipf4) Protein, His-Tagged
Cat.No. : | RFL12259DF |
Product Overview : | Recombinant Full Length Danio rerio Protein YIPF4(yipf4) Protein (Q6NYF1) (1-237aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-237) |
Form : | Lyophilized powder |
AA Sequence : | MQFSPTNGDFTFVSSTDAEELSGTIDAPDITLNMGPESNRDTYATTFLRQRGYGWLLEVE EEESEDTKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLLFSM ISIYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVSYGQVLGVIGYSLLPLIVIAPLLLV IGGFEVVSTLIKLFGVFWAAYSAASLLVGDEFKTKKPLLIYPIFLLYIYFLSLYTGV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yipf4 |
Synonyms | yipf4; zgc:77069; Protein YIPF4; YIP1 family member 4 |
UniProt ID | Q6NYF1 |
◆ Recombinant Proteins | ||
YIPF4-5239R | Recombinant Rhesus monkey YIPF4 Protein, His-tagged | +Inquiry |
RFL25726RF | Recombinant Full Length Rat Protein Yipf4(Yipf4) Protein, His-Tagged | +Inquiry |
YIPF4-18662M | Recombinant Mouse YIPF4 Protein | +Inquiry |
RFL30545GF | Recombinant Full Length Chicken Protein Yipf4(Yipf4) Protein, His-Tagged | +Inquiry |
YIPF4-5052R | Recombinant Rhesus Macaque YIPF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YIPF4-244HCL | Recombinant Human YIPF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All yipf4 Products
Required fields are marked with *
My Review for All yipf4 Products
Required fields are marked with *