Recombinant Full Length Danio Rerio Upf0542 Protein C5Orf43 Homolog (Si:Ch211-198N5.13, Zgc:162244) Protein, His-Tagged
| Cat.No. : | RFL17997DF |
| Product Overview : | Recombinant Full Length Danio rerio UPF0542 protein C5orf43 homolog (si:ch211-198n5.13, zgc:162244) Protein (A3KNM5) (1-74aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-74) |
| Form : | Lyophilized powder |
| AA Sequence : | MIDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFIASALLSWKLAKMIEAKDREQKKKQK RQENIAKAKRAKKD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | smim15 |
| Synonyms | smim15; si:ch211-198n5.13; zgc:162244; Small integral membrane protein 15 |
| UniProt ID | A3KNM5 |
| ◆ Recombinant Proteins | ||
| SMIM15-1908H | Recombinant Human SMIM15 Protein, MYC/DDK-tagged | +Inquiry |
| SMIM15-3927HF | Recombinant Full Length Human SMIM15 Protein, GST-tagged | +Inquiry |
| SMIM15-3212H | Recombinant Human SMIM15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL17997DF | Recombinant Full Length Danio Rerio Upf0542 Protein C5Orf43 Homolog (Si:Ch211-198N5.13, Zgc:162244) Protein, His-Tagged | +Inquiry |
| Smim15-5969M | Recombinant Mouse Smim15 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All smim15 Products
Required fields are marked with *
My Review for All smim15 Products
Required fields are marked with *
