Recombinant Full Length Human SMIM15 Protein, GST-tagged
| Cat.No. : | SMIM15-3927HF | 
| Product Overview : | Human C5orf43 full-length ORF (1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 74 amino acids | 
| Description : | SMIM15 (Small Integral Membrane Protein 15) is a Protein Coding gene. | 
| Molecular Mass : | 34.54 kDa | 
| AA Sequence : | MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | SMIM15 small integral membrane protein 15 [ Homo sapiens (human) ] | 
| Official Symbol | SMIM15 | 
| Synonyms | C5orf43; SMIM15; small integral membrane protein 15; small integral membrane protein 15; UPF0542 protein C5orf43 | 
| Gene ID | 643155 | 
| mRNA Refseq | NM_001048249 | 
| Protein Refseq | NP_001041714 | 
| UniProt ID | Q7Z3B0 | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All SMIM15 Products
Required fields are marked with *
My Review for All SMIM15 Products
Required fields are marked with *
  
        
    
      
            