Recombinant Full Length Human SMIM15 Protein, GST-tagged

Cat.No. : SMIM15-3927HF
Product Overview : Human C5orf43 full-length ORF (1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 74 amino acids
Description : SMIM15 (Small Integral Membrane Protein 15) is a Protein Coding gene.
Molecular Mass : 34.54 kDa
AA Sequence : MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SMIM15 small integral membrane protein 15 [ Homo sapiens (human) ]
Official Symbol SMIM15
Synonyms C5orf43; SMIM15; small integral membrane protein 15; small integral membrane protein 15; UPF0542 protein C5orf43
Gene ID 643155
mRNA Refseq NM_001048249
Protein Refseq NP_001041714
UniProt ID Q7Z3B0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMIM15 Products

Required fields are marked with *

My Review for All SMIM15 Products

Required fields are marked with *

0
cart-icon