Recombinant Full Length Dictyostelium Discoideum Adenosine 3'-Phospho 5'-Phosphosulfate Transporter 1(Slc35B2) Protein, His-Tagged
Cat.No. : | RFL22028DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Adenosine 3'-phospho 5'-phosphosulfate transporter 1(slc35b2) Protein (Q55DM5) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MGSGIEVNDSSTTNSNNNEKVQLSYNMKLALATGGIMGSFLLYGILQERLMVVPYKNADG SEEYFTDSTFLVLSNRVFAALMAIVIVLKRGESLKNVAPLHKYVGVALSNFCATWCQYEA LKYVNFPTQTLGKCGKMLPVMLVGTFISGKKYGLKDYSIALTITTGCMIFFLTGKISNNE SSNTSYGIILMALYMFFDSFTSTFQEKMFKGYTMSTYDQMIYVNGCSSIISVFILILNGR LFPAIEFISTHNGVFFDSTMLSASAGLGQMVIYYTIKEFGALVFSTIMVTRQMVSIILST LIYLHPLSNTQWIGALLVFGTLYYKSIEDSKKKHGGHSHGGSNAATTTTPSNNSNNTEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc35b2 |
Synonyms | slc35b2; papst1; DDB_G0269602; Adenosine 3'-phospho 5'-phosphosulfate transporter 1; PAPS transporter 1; Solute carrier family 35 member B2 |
UniProt ID | Q55DM5 |
◆ Recombinant Proteins | ||
SLC35B2-11667Z | Recombinant Zebrafish SLC35B2 | +Inquiry |
RFL22028DF | Recombinant Full Length Dictyostelium Discoideum Adenosine 3'-Phospho 5'-Phosphosulfate Transporter 1(Slc35B2) Protein, His-Tagged | +Inquiry |
Slc35b2-2696M | Recombinant Mouse Slc35b2 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC35B2-606HCL | Recombinant Human SLC35B2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc35b2 Products
Required fields are marked with *
My Review for All slc35b2 Products
Required fields are marked with *
0
Inquiry Basket