Recombinant Full Length Dictyostelium Discoideum Cytochrome C1, Heme Protein, Mitochondrial(Cyc1) Protein, His-Tagged
Cat.No. : | RFL29898DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Cytochrome c1, heme protein, mitochondrial(cyc1) Protein (Q54D07) (29-275aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-275) |
Form : | Lyophilized powder |
AA Sequence : | ITTSTTLLSDDFVQPTSYPWEHRFPWQSYDHAAIRRGHQVYTQVCSTCHSLNLISYRHLA NVAYTPEELKAMAADTTVMDGPDSEGDMFERKGQVTDFHPKPYPNSNAARFANNGALPPD LSLVIKARGAHEDYVFSLLTGYCEPPAGVRVVGGQYFNPYFPGTKIAMAPPLADGMVEYD DGTDNSMSQMAKDVSTFLCWASEPEHDDRKKLGMKVLLGVSIIALPLFYWKRLKWSVIKT RKISFKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cyc1 |
Synonyms | cyc1; DDB_G0292594; Cytochrome c1, heme protein, mitochondrial; Cytochrome c-1; Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4 |
UniProt ID | Q54D07 |
◆ Recombinant Proteins | ||
CYC1-20H | Recombinant Human CYC1 protein, GST-tagged | +Inquiry |
CYC1-467Y | Recombinant Yeast Cyc1p | +Inquiry |
CYC1-955R | Recombinant Rhesus Macaque CYC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28798BF | Recombinant Full Length Bovine Cytochrome C1, Heme Protein, Mitochondrial(Cyc1) Protein, His-Tagged | +Inquiry |
CYC1-2390HF | Recombinant Full Length Human CYC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYC1-7136HCL | Recombinant Human CYC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cyc1 Products
Required fields are marked with *
My Review for All cyc1 Products
Required fields are marked with *
0
Inquiry Basket