Recombinant Full Length Dictyostelium Discoideum Translocon-Associated Protein Subunit Gamma(Ssr3) Protein, His-Tagged
Cat.No. : | RFL27291DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Translocon-associated protein subunit gamma(ssr3) Protein (Q55GT5) (1-170aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-170) |
Form : | Lyophilized powder |
AA Sequence : | MAEVDEFSAFRHENDVSIEQRIVYFINSLIVALVPVYLYHAIFFMSIDDHMIIYGSVTLF AAIVLTFAYNNIYRMKRLKLSASREHISIASKNKVGDKKKFAAAQKEVQALVTSHEAIAA SIMYNNAVFLICVSIFSFIIFKNVPLVYNYIISISLGAGLTSFLSTSSKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ssr3 |
Synonyms | ssr3; DDB_G0267524; Translocon-associated protein subunit gamma; TRAP-gamma; Signal sequence receptor subunit gamma; SSR-gamma |
UniProt ID | Q55GT5 |
◆ Recombinant Proteins | ||
Ssr3-6145M | Recombinant Mouse Ssr3 Protein, Myc/DDK-tagged | +Inquiry |
SSR3-2399H | Recombinant Human SSR3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL659HF | Recombinant Full Length Human Translocon-Associated Protein Subunit Gamma(Ssr3) Protein, His-Tagged | +Inquiry |
SSR3-4871C | Recombinant Chicken SSR3 | +Inquiry |
SSR3-4491R | Recombinant Rhesus monkey SSR3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSR3-1458HCL | Recombinant Human SSR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ssr3 Products
Required fields are marked with *
My Review for All ssr3 Products
Required fields are marked with *
0
Inquiry Basket