Recombinant Full Length Dog B-Lymphocyte Antigen Cd20(Ms4A1) Protein, His-Tagged
| Cat.No. : | RFL16853CF | 
| Product Overview : | Recombinant Full Length Dog B-lymphocyte antigen CD20(MS4A1) Protein (Q3C2E2) (1-297aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length (1-297) | 
| Form : | Lyophilized powder | 
| AA Sequence : | MTTPRNSMSGTLPVDPMKSPTAMYPVQKIIPKRMPSVVGPTQNFFMRESKTLGAVQIMNG LFHIALGSLLMIHTDVCAPICITMWYPLWGGIMFIISGSLLAAADKNPRKSLVKGKMIMN SLSLFAAISGIIFLIMDIFNITISHFFKMENLNLIKAPMPYVDIHNCDPANPSEKNSLSI QYCGSIRSVFLGVFAVMLIFAFFQKLVTAGIVENEWKKLCSKPKSDVVVLLAAEEKKEQP IETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | MS4A1 | 
| Synonyms | MS4A1; CD20; B-lymphocyte antigen CD20; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20 | 
| UniProt ID | Q3C2E2 | 
| ◆ Recombinant Proteins | ||
| MS4A1-09FF | Recombinant Ferret MS4A1 Protein, His-tagged, FITC conjugated | +Inquiry | 
| MS4A1-48392H | Active Recombinant Human MS4A1 protein, His-tagged | +Inquiry | 
| MS4A1-5732M | Recombinant Mouse MS4A1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MS4A1-3929H | Recombinant Human MS4A1 full length protein, His-tagged(Nanodisc) | +Inquiry | 
| MS4A1-3048C | Active Recombinant Canine MS4A1 protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry | 
| MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry | 
| MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A1 Products
Required fields are marked with *
My Review for All MS4A1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            