Recombinant Full Length Dog B-Lymphocyte Antigen Cd20(Ms4A1) Protein, His-Tagged
Cat.No. : | RFL16853CF |
Product Overview : | Recombinant Full Length Dog B-lymphocyte antigen CD20(MS4A1) Protein (Q3C2E2) (1-297aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-297) |
Form : | Lyophilized powder |
AA Sequence : | MTTPRNSMSGTLPVDPMKSPTAMYPVQKIIPKRMPSVVGPTQNFFMRESKTLGAVQIMNG LFHIALGSLLMIHTDVCAPICITMWYPLWGGIMFIISGSLLAAADKNPRKSLVKGKMIMN SLSLFAAISGIIFLIMDIFNITISHFFKMENLNLIKAPMPYVDIHNCDPANPSEKNSLSI QYCGSIRSVFLGVFAVMLIFAFFQKLVTAGIVENEWKKLCSKPKSDVVVLLAAEEKKEQP IETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MS4A1 |
Synonyms | MS4A1; CD20; B-lymphocyte antigen CD20; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20 |
UniProt ID | Q3C2E2 |
◆ Recombinant Proteins | ||
MS4A1-3931H | Active Recombinant Human MS4A1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
MS4A1-5471H | Recombinant Human MS4A1 protein, His-tagged | +Inquiry |
MS4A1-1649H | Recombinant Human MS4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL16853CF | Recombinant Full Length Dog B-Lymphocyte Antigen Cd20(Ms4A1) Protein, His-Tagged | +Inquiry |
MS4A1-62C | Recombinant Cynomolgus MS4A1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MS4A1 Products
Required fields are marked with *
My Review for All MS4A1 Products
Required fields are marked with *
0
Inquiry Basket