Recombinant Full Length Dog Inward Rectifier Potassium Channel 2(Kcnj2) Protein, His-Tagged
Cat.No. : | RFL17003CF |
Product Overview : | Recombinant Full Length Dog Inward rectifier potassium channel 2(KCNJ2) Protein (Q9MYY9) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDLDLHNQASVPLEPRP LRRESEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNJ2 |
Synonyms | KCNJ2; IRK1; Inward rectifier potassium channel 2; Cardiac inward rectifier potassium channel; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2 |
UniProt ID | Q9MYY9 |
◆ Recombinant Proteins | ||
KCNJ2-8517M | Recombinant Mouse KCNJ2 Protein | +Inquiry |
KCNJ2-3200R | Recombinant Rat KCNJ2 Protein | +Inquiry |
RFL36612MF | Recombinant Full Length Mouse Inward Rectifier Potassium Channel 2(Kcnj2) Protein, His-Tagged | +Inquiry |
RFL13742CF | Recombinant Full Length Guinea Pig Inward Rectifier Potassium Channel 2(Kcnj2) Protein, His-Tagged | +Inquiry |
KCNJ2-27881TH | Recombinant Human KCNJ2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNJ2 Products
Required fields are marked with *
My Review for All KCNJ2 Products
Required fields are marked with *
0
Inquiry Basket