Recombinant Full Length Dog Keratinocyte-Associated Protein 2(Krtcap2) Protein, His-Tagged
Cat.No. : | RFL18966CF |
Product Overview : | Recombinant Full Length Dog Keratinocyte-associated protein 2(KRTCAP2) Protein (P86229) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MAVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAT PVLTPAKVTGKGKKRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KRTCAP2 |
Synonyms | KRTCAP2; KCP2; Keratinocyte-associated protein 2; KCP-2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2 |
UniProt ID | P86229 |
◆ Recombinant Proteins | ||
KRTCAP2-4963M | Recombinant Mouse KRTCAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTCAP2-4800H | Recombinant Human KRTCAP2 Protein, GST-tagged | +Inquiry |
RFL17318RF | Recombinant Full Length Rat Keratinocyte-Associated Protein 2(Krtcap2) Protein, His-Tagged | +Inquiry |
KRTCAP2-4339Z | Recombinant Zebrafish KRTCAP2 | +Inquiry |
RFL27500BF | Recombinant Full Length Bovine Keratinocyte-Associated Protein 2(Krtcap2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTCAP2-371HCL | Recombinant Human KRTCAP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTCAP2 Products
Required fields are marked with *
My Review for All KRTCAP2 Products
Required fields are marked with *