Recombinant Full Length Guinea Pig Leukotriene C4 Synthase(Ltc4S) Protein, His-Tagged
Cat.No. : | RFL27302CF |
Product Overview : | Recombinant Full Length Guinea pig Leukotriene C4 synthase(LTC4S) Protein (A6XA80) (1-150aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-150) |
Form : | Lyophilized powder |
AA Sequence : | MKDEVALLATVTLLGVLLQAYFSLQVIRARRAHRVSPPLTTGPPEFERVYRAQVNCSEYF PLFLATLWVAGVYFHEGAAALCGLVYLFTRLRYFWGYARSAQLRLAPLYASARALWLLLA LATLGLLAHFLPAAARAALLRLLRALLRTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LTC4S |
Synonyms | LTC4S; Leukotriene C4 synthase; LTC4 synthase; Glutathione S-transferase LTC4; Leukotriene-C(4 synthase |
UniProt ID | A6XA80 |
◆ Recombinant Proteins | ||
LTC4S-3158R | Recombinant Rat LTC4S Protein, His (Fc)-Avi-tagged | +Inquiry |
LTC4S-4045H | Recombinant Human LTC4S Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL3248BF | Recombinant Full Length Bovine Leukotriene C4 Synthase(Ltc4S) Protein, His-Tagged | +Inquiry |
LTC4S-6209HF | Recombinant Full Length Human LTC4S Protein, GST-tagged | +Inquiry |
Ltc4s-3863M | Recombinant Mouse Ltc4s Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTC4S-668HCL | Recombinant Human LTC4S cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTC4S Products
Required fields are marked with *
My Review for All LTC4S Products
Required fields are marked with *
0
Inquiry Basket