Recombinant Full Length Human 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Gamma(Agpat3) Protein, His-Tagged
Cat.No. : | RFL28489HF |
Product Overview : | Recombinant Full Length Human 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma(AGPAT3) Protein (Q9NRZ7) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQ LVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKV LAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRF TETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSL LGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPGEQFK PARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTE IEKGSSYGNQEFKKKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AGPAT3 |
Synonyms | AGPAT3; LPAAT3; UNQ759/PRO1490; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-AGP acyltransferase 3; 1-AGPAT 3; Lysophosphatidic acid acyltransferase gamma; LPAAT-gamma |
UniProt ID | Q9NRZ7 |
◆ Recombinant Proteins | ||
AGPAT3-431H | Recombinant Human AGPAT3 Protein, GST-tagged | +Inquiry |
AGPAT3-931HF | Recombinant Full Length Human AGPAT3 Protein, GST-tagged | +Inquiry |
AGPAT3-12597Z | Recombinant Zebrafish AGPAT3 | +Inquiry |
RFL27810PF | Recombinant Full Length Pongo Abelii 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Gamma(Agpat3) Protein, His-Tagged | +Inquiry |
AGPAT3-3665H | Recombinant Human AGPAT3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT3-8976HCL | Recombinant Human AGPAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT3 Products
Required fields are marked with *
My Review for All AGPAT3 Products
Required fields are marked with *