Recombinant Full Length Human 2-Acylglycerol O-Acyltransferase 1(Mogat1) Protein, His-Tagged
| Cat.No. : | RFL16306HF |
| Product Overview : | Recombinant Full Length Human 2-acylglycerol O-acyltransferase 1(MOGAT1) Protein (Q96PD6) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-335) |
| Form : | Lyophilized powder |
| AA Sequence : | MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYF DWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFG NFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGN ISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPE GSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQE QIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MOGAT1 |
| Synonyms | MOGAT1; DC2; DGAT2L1; 2-acylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; MGAT1; Diacylglycerol O-acyltransferase candidate 2; hDC2; Diacylglycerol acyltransferase 2-like protein 1; Monoacylglycerol O-acyltransferase 1 |
| UniProt ID | Q96PD6 |
| ◆ Recombinant Proteins | ||
| MOGAT1-6303HF | Recombinant Full Length Human MOGAT1 Protein, GST-tagged | +Inquiry |
| MOGAT1-3996H | Recombinant Human MOGAT1 Protein (Arg153-Lys335), N-His tagged | +Inquiry |
| RFL27067MF | Recombinant Full Length Mouse 2-Acylglycerol O-Acyltransferase 1(Mogat1) Protein, His-Tagged | +Inquiry |
| MOGAT1-9952M | Recombinant Mouse MOGAT1 Protein | +Inquiry |
| MOGAT1-5467H | Recombinant Human MOGAT1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOGAT1-1127HCL | Recombinant Human MOGAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOGAT1 Products
Required fields are marked with *
My Review for All MOGAT1 Products
Required fields are marked with *
