Recombinant Full Length Human MOGAT1 Protein, GST-tagged
Cat.No. : | MOGAT1-6303HF |
Product Overview : | Human MOGAT1 full-length ORF ( AAI46519.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 334 amino acids |
Description : | Acyl-CoA: monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM |
Molecular Mass : | 63.69 kDa |
AA Sequence : | MKVEFAPLNIQLARRLQTVAVLQWVLSFLTGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOGAT1 monoacylglycerol O-acyltransferase 1 [ Homo sapiens ] |
Official Symbol | MOGAT1 |
Synonyms | MOGAT1; monoacylglycerol O-acyltransferase 1; DGAT2L1, diacylglycerol O acyltransferase 2 like 1; 2-acylglycerol O-acyltransferase 1; DGAT2L; MGAT1; hDC2; diacylglycerol O-acyltransferase 2 like 1; acyl-CoA:monoacylglycerol acyltransferase 1; diacylglycerol O-acyltransferase candidate 2; diacylglycerol acyltransferase 2-like protein 1; DGAT2L1; |
Gene ID | 116255 |
mRNA Refseq | NM_058165 |
Protein Refseq | NP_477513 |
MIM | 610268 |
UniProt ID | Q96PD6 |
◆ Cell & Tissue Lysates | ||
MOGAT1-1127HCL | Recombinant Human MOGAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOGAT1 Products
Required fields are marked with *
My Review for All MOGAT1 Products
Required fields are marked with *