Recombinant Full Length Human 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1(Srd5A1) Protein, His-Tagged
| Cat.No. : | RFL32706HF |
| Product Overview : | Recombinant Full Length Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1(SRD5A1) Protein (P18405) (1-259aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-259) |
| Form : | Lyophilized powder |
| AA Sequence : | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SRD5A1 |
| Synonyms | SRD5A1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; Steroid 5-alpha-reductase 1; S5AR 1 |
| UniProt ID | P18405 |
| ◆ Recombinant Proteins | ||
| SRD5A1-85H | Recombinant Human SRD5A1, GST-tagged | +Inquiry |
| SRD5A1-4535Z | Recombinant Zebrafish SRD5A1 | +Inquiry |
| RFL15610BF | Recombinant Full Length Bovine 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1(Srd5A1) Protein, His-Tagged | +Inquiry |
| SRD5A1-973C | Recombinant Cynomolgus SRD5A1 Protein, His-tagged | +Inquiry |
| SRD5A1-2624H | Recombinant Human SRD5A1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRD5A1-1690HCL | Recombinant Human SRD5A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRD5A1 Products
Required fields are marked with *
My Review for All SRD5A1 Products
Required fields are marked with *
