Recombinant Full Length Human ABHD6 Protein, C-Flag-tagged
Cat.No. : | ABHD6-475HFL |
Product Overview : | Recombinant Full Length Human ABHD6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Lipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol. Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways (By similarity). Also has a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids (By similarity). Also able to degrade bis(monoacylglycero)phosphate (BMP) and constitutes the major enzyme for BMP catabolism. BMP, also known as lysobisphosphatidic acid, is enriched in late endosomes and lysosomes and plays a key role in the formation of intraluminal vesicles and in lipid sorting. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.2 kDa |
AA Sequence : | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGH KPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKK PFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEM SEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQV LDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | ABHD6 abhydrolase domain containing 6, acylglycerol lipase [ Homo sapiens (human) ] |
Official Symbol | ABHD6 |
Synonyms | abhydrolase domain containing 6; lipase protein |
Gene ID | 57406 |
mRNA Refseq | NM_020676.7 |
Protein Refseq | NP_065727.4 |
MIM | 616966 |
UniProt ID | Q9BV23 |
◆ Recombinant Proteins | ||
ABHD6-6843H | Recombinant Human ABHD6 protein, His-tagged | +Inquiry |
AMTN-390H | Recombinant Human AMTN protein, His-tagged | +Inquiry |
ABHD6-475HFL | Recombinant Full Length Human ABHD6 Protein, C-Flag-tagged | +Inquiry |
ABHD6-22R | Recombinant Rhesus Macaque ABHD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD6-79R | Recombinant Rat ABHD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD6-9131HCL | Recombinant Human ABHD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABHD6 Products
Required fields are marked with *
My Review for All ABHD6 Products
Required fields are marked with *
0
Inquiry Basket