Recombinant Full Length Human ACKR1 Protein

Cat.No. : ACKR1-2513HF
Product Overview : Human DARC full-length ORF (NP_002027.2) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 336 amino acids
Description : The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : 35.6 kDa
AA Sequence : MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name ACKR1 atypical chemokine receptor 1 (Duffy blood group) [ Homo sapiens (human) ]
Official Symbol ACKR1
Synonyms ACKR1; atypical chemokine receptor 1 (Duffy blood group); DARC; Duffy blood group, chemokine receptor; Duffy blood group , FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor; FY; GpFy; WBCQ1;
Gene ID 2532
mRNA Refseq NM_001122951
Protein Refseq NP_001116423
MIM 613665
UniProt ID Q16570

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACKR1 Products

Required fields are marked with *

My Review for All ACKR1 Products

Required fields are marked with *

0
cart-icon