Recombinant Full Length Human ACVRL1 Protein, C-Flag-tagged
Cat.No. : | ACVRL1-1507HFL |
Product Overview : | Recombinant Full Length Human ACVRL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.9 kDa |
AA Sequence : | MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG NLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGL WHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGK GRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYH EHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLG LAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQ KISNSPEKPKVIQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Full Length : | Full L. |
Gene Name | ACVRL1 activin A receptor like type 1 [ Homo sapiens (human) ] |
Official Symbol | ACVRL1 |
Synonyms | HHT; ALK1; HHT2; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1 |
Gene ID | 94 |
mRNA Refseq | NM_001077401.2 |
Protein Refseq | NP_001070869.1 |
MIM | 601284 |
UniProt ID | P37023 |
◆ Recombinant Proteins | ||
ACVRL1-276H | Recombinant Human ACVRL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACVRL1-5332H | Recombinant Human ACVRL1 Protein (Met1-Gln118), C-Fc tagged | +Inquiry |
Acvrl1-530M | Recombinant Mouse Acvrl1 Protein, MYC/DDK-tagged | +Inquiry |
ACVRL1-644H | Recombinant Human ACVRL1 protein, His-tagged | +Inquiry |
Acvrl1-2333M | Active Recombinant Mouse Acvrl1 protein(Met1-Pro119), His&hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVRL1-1191CCL | Recombinant Cynomolgus ACVRL1 cell lysate | +Inquiry |
ACVRL1-3093MCL | Recombinant Mouse ACVRL1 cell lysate | +Inquiry |
ACVRL1-2629HCL | Recombinant Human ACVRL1 cell lysate | +Inquiry |
ACVRL1-994CCL | Recombinant Canine ACVRL1 cell lysate | +Inquiry |
ACVRL1-3001RCL | Recombinant Rat ACVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVRL1 Products
Required fields are marked with *
My Review for All ACVRL1 Products
Required fields are marked with *
0
Inquiry Basket