Recombinant Full Length Human Acyl-Coa Wax Alcohol Acyltransferase 1(Awat1) Protein, His-Tagged
| Cat.No. : | RFL22590HF |
| Product Overview : | Recombinant Full Length Human Acyl-CoA wax alcohol acyltransferase 1(AWAT1) Protein (Q58HT5) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-328) |
| Form : | Lyophilized powder |
| AA Sequence : | MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPE RGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA TGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVG GVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKF QSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHA LYMDALHKLFDQHKTHYGCSETQKLFFL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | AWAT1 |
| Synonyms | AWAT1; DGA2; DGAT2L3; Acyl-CoA wax alcohol acyltransferase 1; Diacylglycerol O-acyltransferase 2-like protein 3; Diacylglycerol acyltransferase 2; Long-chain-alcohol O-fatty-acyltransferase 1 |
| UniProt ID | Q58HT5 |
| ◆ Recombinant Proteins | ||
| Awat1-3130M | Recombinant Mouse Awat1, His-tagged | +Inquiry |
| AWAT1-2218M | Recombinant Mouse AWAT1 Protein | +Inquiry |
| AWAT1-2522H | Recombinant Human AWAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL35789MF | Recombinant Full Length Mouse Acyl-Coa Wax Alcohol Acyltransferase 1(Awat1) Protein, His-Tagged | +Inquiry |
| RFL22590HF | Recombinant Full Length Human Acyl-Coa Wax Alcohol Acyltransferase 1(Awat1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AWAT1-8556HCL | Recombinant Human AWAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AWAT1 Products
Required fields are marked with *
My Review for All AWAT1 Products
Required fields are marked with *
