Recombinant Full Length Human ADIPOR1 Protein, C-Flag-tagged
Cat.No. : | ADIPOR1-691HFL |
Product Overview : | Recombinant Full Length Human ADIPOR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.4 kDa |
AA Sequence : | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV HFYGVSNLQEFRYGLEGGCTDDTLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Adipocytokine signaling pathway |
Full Length : | Full L. |
Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens (human) ] |
Official Symbol | ADIPOR1 |
Synonyms | CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A |
Gene ID | 51094 |
mRNA Refseq | NM_015999.6 |
Protein Refseq | NP_057083.2 |
MIM | 607945 |
UniProt ID | Q96A54 |
◆ Recombinant Proteins | ||
ADIPOR1-1354H | Recombinant Human ADIPOR1 Transmembrane protein, His-Flag-tagged | +Inquiry |
ADIPOR1-625H | Recombinant Human ADIPOR1, GST-tagged | +Inquiry |
ADIPOR1-691HFL | Recombinant Full Length Human ADIPOR1 Protein, C-Flag-tagged | +Inquiry |
Adipor1-84M | Recombinant Mouse Adipor1 Protein, His&MBP-tagged | +Inquiry |
ADIPOR1-248R | Recombinant Rhesus monkey ADIPOR1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *