Recombinant Full Length Human ADSS2 Protein, C-Flag-tagged
Cat.No. : | ADSS2-266HFL |
Product Overview : | Recombinant Full Length Human ADSS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the enzyme adenylosuccinate synthetase which catalyzes the first committed step in the conversion of inosine monophosphate to adenosine monophosphate. A pseudogene of this gene is found on chromosome 17. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTV VVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFH QAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLE IDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVC TGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAH MINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism |
Full Length : | Full L. |
Gene Name | ADSS2 adenylosuccinate synthase 2 [ Homo sapiens (human) ] |
Official Symbol | ADSS2 |
Synonyms | ADEH; ADSS |
Gene ID | 159 |
mRNA Refseq | NM_001126.5 |
Protein Refseq | NP_001117.2 |
MIM | 103060 |
UniProt ID | P30520 |
◆ Recombinant Proteins | ||
ADSS2-287H | Recombinant Human ADSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADSS2-266HFL | Recombinant Full Length Human ADSS2 Protein, C-Flag-tagged | +Inquiry |
ADSS2-5549H | Recombinant Human ADSS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADSS-9451H | Recombinant human ADSS2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADSS2 Products
Required fields are marked with *
My Review for All ADSS2 Products
Required fields are marked with *