Recombinant Full Length Human AFMID Protein, C-Flag-tagged
Cat.No. : | AFMID-1534HFL |
Product Overview : | Recombinant Full Length Human AFMID Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable hydrolase activity. Predicted to be involved in tryptophan catabolic process to kynurenine. Predicted to be located in cytosol and nucleus. Predicted to be active in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.8 kDa |
AA Sequence : | MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD GEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQ VTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLEPIVYTSQNVA LQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHF EIVENLTQKDNVLTQIILKTIFQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Tryptophan metabolism |
Full Length : | Full L. |
Gene Name | AFMID arylformamidase [ Homo sapiens (human) ] |
Official Symbol | AFMID |
Synonyms | KF; FKF; KFA |
Gene ID | 125061 |
mRNA Refseq | NM_001010982.5 |
Protein Refseq | NP_001010982.2 |
UniProt ID | Q63HM1 |
◆ Recombinant Proteins | ||
Afmid-1549M | Recombinant Mouse Afmid Protein, Myc/DDK-tagged | +Inquiry |
AFMID-992HF | Recombinant Full Length Human AFMID Protein, GST-tagged | +Inquiry |
AFMID-92H | Recombinant Human AFMID Protein, His&GST-tagged | +Inquiry |
AFMID-546H | Recombinant Human AFMID Protein, MYC/DDK-tagged | +Inquiry |
AFMID-2437Z | Recombinant Zebrafish AFMID | +Inquiry |
◆ Cell & Tissue Lysates | ||
AFMID-14HCL | Recombinant Human AFMID lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AFMID Products
Required fields are marked with *
My Review for All AFMID Products
Required fields are marked with *
0
Inquiry Basket