Recombinant Full Length Human AGFG1 Protein, GST-tagged

Cat.No. : AGFG1-3656HF
Product Overview : Human HRB full-length ORF ( NP_004495.2, 1 a.a. - 562 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 562 amino acids
Description : The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. The encoded protein binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 84.7 kDa
AA Sequence : MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGFG1 ArfGAP with FG repeats 1 [ Homo sapiens ]
Official Symbol AGFG1
Synonyms AGFG1; ArfGAP with FG repeats 1; HIV 1 Rev binding protein , HRB; arf-GAP domain and FG repeat-containing protein 1; RAB; RIP; rev-interacting protein; HIV-1 Rev binding protein; HIV-1 Rev-binding protein; nucleoporin-like protein RIP; hRIP, Rev interacting protein; rev/Rex activation domain-binding protein; Rab, Rev/Rex activation domain-binding protein; arf-GAP domain and FG repeats-containing protein 1; HRB; MGC116938; MGC116940; DKFZp686I15205;
Gene ID 3267
mRNA Refseq NM_001135187
Protein Refseq NP_001128659
MIM 600862
UniProt ID P52594

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGFG1 Products

Required fields are marked with *

My Review for All AGFG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon