Recombinant Full Length Human AGFG1 Protein, GST-tagged
Cat.No. : | AGFG1-3656HF |
Product Overview : | Human HRB full-length ORF ( NP_004495.2, 1 a.a. - 562 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 562 amino acids |
Description : | The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. The encoded protein binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 84.7 kDa |
AA Sequence : | MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGFG1 ArfGAP with FG repeats 1 [ Homo sapiens ] |
Official Symbol | AGFG1 |
Synonyms | AGFG1; ArfGAP with FG repeats 1; HIV 1 Rev binding protein , HRB; arf-GAP domain and FG repeat-containing protein 1; RAB; RIP; rev-interacting protein; HIV-1 Rev binding protein; HIV-1 Rev-binding protein; nucleoporin-like protein RIP; hRIP, Rev interacting protein; rev/Rex activation domain-binding protein; Rab, Rev/Rex activation domain-binding protein; arf-GAP domain and FG repeats-containing protein 1; HRB; MGC116938; MGC116940; DKFZp686I15205; |
Gene ID | 3267 |
mRNA Refseq | NM_001135187 |
Protein Refseq | NP_001128659 |
MIM | 600862 |
UniProt ID | P52594 |
◆ Recombinant Proteins | ||
AGFG1-558R | Recombinant Rat AGFG1 Protein | +Inquiry |
AGFG1-3612H | Recombinant Human AGFG1, His-tagged | +Inquiry |
AGFG1-3656HF | Recombinant Full Length Human AGFG1 Protein, GST-tagged | +Inquiry |
AGFG1-1414M | Recombinant Mouse AGFG1 Protein | +Inquiry |
AGFG1-214R | Recombinant Rat AGFG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGFG1-8982HCL | Recombinant Human AGFG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGFG1 Products
Required fields are marked with *
My Review for All AGFG1 Products
Required fields are marked with *
0
Inquiry Basket