Recombinant Full Length Human AHCYL1 Protein, C-Flag-tagged
Cat.No. : | AHCYL1-1389HFL |
Product Overview : | Recombinant Full Length Human AHCYL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene interacts with inositol 1,4,5-trisphosphate receptor, type 1 and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.8 kDa |
AA Sequence : | MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQS STDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGE KPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWW CIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVND SVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQA CMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR SQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDE YVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism |
Full Length : | Full L. |
Gene Name | AHCYL1 adenosylhomocysteinase like 1 [ Homo sapiens (human) ] |
Official Symbol | AHCYL1 |
Synonyms | DCAL; IRBIT; PPP1R78; PRO0233; XPVKONA |
Gene ID | 10768 |
mRNA Refseq | NM_006621.7 |
Protein Refseq | NP_006612.2 |
MIM | 607826 |
UniProt ID | O43865 |
◆ Recombinant Proteins | ||
AHCYL1-859H | Recombinant Human AHCYL1 | +Inquiry |
AHCYL1-456H | Recombinant Human AHCYL1 Protein, GST-tagged | +Inquiry |
AHCYL1-100H | Recombinant Human AHCYL1 Protein, His-tagged | +Inquiry |
AHCYL1-276R | Recombinant Rhesus monkey AHCYL1 Protein, His-tagged | +Inquiry |
AHCYL1-1389HFL | Recombinant Full Length Human AHCYL1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHCYL1-39HCL | Recombinant Human AHCYL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHCYL1 Products
Required fields are marked with *
My Review for All AHCYL1 Products
Required fields are marked with *
0
Inquiry Basket