Recombinant Full Length Human AHSG Protein, C-Flag-tagged
Cat.No. : | AHSG-446HFL |
Product Overview : | Recombinant Full Length Human AHSG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA AGPVVPPCPGRIRHFKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | AHSG alpha 2-HS glycoprotein [ Homo sapiens (human) ] |
Official Symbol | AHSG |
Synonyms | AHS; A2HS; HSGA; APMR1; FETUA |
Gene ID | 197 |
mRNA Refseq | NM_001622.4 |
Protein Refseq | NP_001613.2 |
MIM | 138680 |
UniProt ID | P02765 |
◆ Recombinant Proteins | ||
AHSG-704H | Recombinant Human AHSG protein, His-tagged | +Inquiry |
Ahsg-7155M | Recombinant Mouse Ahsg Protein, His-tagged | +Inquiry |
AHSG-565H | Recombinant Human alpha-2-HS-glycoprotein, His-tagged | +Inquiry |
Ahsg-408M | Recombinant Mouse Ahsg Protein, His (Fc)-Avi-tagged | +Inquiry |
AHSG-2529H | Recombinant Human AHSG protein(141-280 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *
0
Inquiry Basket