Recombinant Full Length Human AHSG Protein, C-Flag-tagged
| Cat.No. : | AHSG-446HFL |
| Product Overview : | Recombinant Full Length Human AHSG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 39.2 kDa |
| AA Sequence : | MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA AGPVVPPCPGRIRHFKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Secreted Protein |
| Full Length : | Full L. |
| Gene Name | AHSG alpha 2-HS glycoprotein [ Homo sapiens (human) ] |
| Official Symbol | AHSG |
| Synonyms | AHS; A2HS; HSGA; APMR1; FETUA |
| Gene ID | 197 |
| mRNA Refseq | NM_001622.4 |
| Protein Refseq | NP_001613.2 |
| MIM | 138680 |
| UniProt ID | P02765 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *



