Recombinant Full Length Human AKR1B1 Protein, C-Flag-tagged
Cat.No. : | AKR1B1-1172HFL |
Product Overview : | Recombinant Full Length Human AKR1B1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR EELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILD TWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAY SPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Pyruvate metabolism |
Full Length : | Full L. |
Gene Name | AKR1B1 aldo-keto reductase family 1 member B [ Homo sapiens (human) ] |
Official Symbol | AKR1B1 |
Synonyms | AR; ADR; ALR2; ALDR1 |
Gene ID | 231 |
mRNA Refseq | NM_001628.4 |
Protein Refseq | NP_001619.1 |
MIM | 103880 |
UniProt ID | P15121 |
◆ Recombinant Proteins | ||
AKR1B1-304H | Recombinant Human AKR1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1B1-1172HFL | Recombinant Full Length Human AKR1B1 Protein, C-Flag-tagged | +Inquiry |
AKR1B1-596R | Recombinant Rat AKR1B1 Protein | +Inquiry |
AKR1B1-1363HF | Recombinant Full Length Human AKR1B1 Protein, GST-tagged | +Inquiry |
AKR1B1-2496H | Recombinant Human AKR1B1 protein(Met1-Phe316), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1B1-47HCL | Recombinant Human AKR1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1B1 Products
Required fields are marked with *
My Review for All AKR1B1 Products
Required fields are marked with *
0
Inquiry Basket