Recombinant Full Length Human ALOX12 Protein, C-Flag-tagged
Cat.No. : | ALOX12-1478HFL |
Product Overview : | Recombinant Full Length Human ALOX12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on different polyunsaturated fatty acid substrates to generate bioactive lipid mediators including eicosanoids and lipoxins. The encoded enzyme and its reaction products have been shown to regulate platelet function. Elevated expression of this gene has been observed in pancreatic islets derived from human diabetes patients. Allelic variants in this gene may be associated with susceptibility to toxoplasmosis. Multiple pseudogenes of this gene have been identified in the human genome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 75.5 kDa |
AA Sequence : | MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLLQFVRLRKHHW LVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNALDMFQKHREKELKDRQQIYC WATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLSSWNCLEDFDQIFWGQ KSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLPSGMEELRAQLEKELQNGSLFEADFIL LDGIPANVIRGEKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNS DFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVK GDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAWVPNAPCT MRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTD LEKLEKEITARNEQLDWPYEYLKPSCIENSVTISGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Arachidonic acid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ALOX12 arachidonate 12-lipoxygenase, 12S type [ Homo sapiens (human) ] |
Official Symbol | ALOX12 |
Synonyms | LOG12; 12-LOX; 12S-LOX |
Gene ID | 239 |
mRNA Refseq | NM_000697.3 |
Protein Refseq | NP_000688.2 |
MIM | 152391 |
UniProt ID | P18054 |
◆ Recombinant Proteins | ||
ALOX12-1466HF | Recombinant Full Length Human ALOX12 Protein, GST-tagged | +Inquiry |
ALOX12-323H | Recombinant Human ALOX12 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX12-10019Z | Recombinant Zebrafish ALOX12 | +Inquiry |
ALOX12-2197H | Recombinant Human ALOX12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALOX12-2031H | Recombinant Human ALOX12 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX12-64HCL | Recombinant Human ALOX12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALOX12 Products
Required fields are marked with *
My Review for All ALOX12 Products
Required fields are marked with *
0
Inquiry Basket