Recombinant Full Length Human ALPG Protein, C-Flag-tagged
| Cat.No. : | ALPG-121HFL |
| Product Overview : | Recombinant Full Length Human ALPG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 55.2 kDa |
| AA Sequence : | MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTA ARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC NTTRGNEVISVVNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLI SNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTET IMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY TACDLAPPAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Protein Pathways : | Folate biosynthesis, Metabolic pathways |
| Full Length : | Full L. |
| Gene Name | ALPG alkaline phosphatase, germ cell [ Homo sapiens (human) ] |
| Official Symbol | ALPG |
| Synonyms | GCAP; ALPPL; ALPPL2 |
| Gene ID | 251 |
| mRNA Refseq | NM_031313.3 |
| Protein Refseq | NP_112603.2 |
| MIM | 171810 |
| UniProt ID | P10696 |
| ◆ Recombinant Proteins | ||
| ALPG-418H | Active Recombinant Human ALPG protein, His-tagged | +Inquiry |
| ALPG-1304H | Recombinant Human ALPG protein, His & Avi-tagged | +Inquiry |
| ALPG-121HFL | Recombinant Full Length Human ALPG Protein, C-Flag-tagged | +Inquiry |
| ALPG-3335H | Recombinant Human ALPG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ALPG-325H | Recombinant Human ALPG Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPG Products
Required fields are marked with *
My Review for All ALPG Products
Required fields are marked with *
