Recombinant Full Length Human ALPG Protein, C-Flag-tagged
Cat.No. : | ALPG-121HFL |
Product Overview : | Recombinant Full Length Human ALPG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.2 kDa |
AA Sequence : | MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTA ARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC NTTRGNEVISVVNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLI SNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTET IMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY TACDLAPPAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Folate biosynthesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ALPG alkaline phosphatase, germ cell [ Homo sapiens (human) ] |
Official Symbol | ALPG |
Synonyms | GCAP; ALPPL; ALPPL2 |
Gene ID | 251 |
mRNA Refseq | NM_031313.3 |
Protein Refseq | NP_112603.2 |
MIM | 171810 |
UniProt ID | P10696 |
◆ Recombinant Proteins | ||
ALPG-483H | Recombinant Human ALPG protein, hFc-tagged | +Inquiry |
ALPG-0051H | Recombinant Human ALPG Protein (Ile20-Arg333), N-His-tagged | +Inquiry |
ALPG-1304H | Recombinant Human ALPG protein, His & Avi-tagged | +Inquiry |
ALPG-121HFL | Recombinant Full Length Human ALPG Protein, C-Flag-tagged | +Inquiry |
ALPG-418H | Active Recombinant Human ALPG protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPG Products
Required fields are marked with *
My Review for All ALPG Products
Required fields are marked with *